PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_1044_iso_8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family VOZ
Protein Properties Length: 484aa    MW: 53897.3 Da    PI: 5.8285
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_1044_iso_8genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ423.43.7e-1302054241217
                                  VOZ   1 pppsaflgpkcalwdctrpaqgsewl...qdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvq 71 
                                          ppp+aflgpkcalwdc+rpaq  ew+   qdycss+hat+a  eg pg++pvlrp+gi+lkd+llfaalsak+q
  cra_locus_1044_iso_8_len_2357_ver_3 205 PPPAAFLGPKCALWDCPRPAQRLEWCqtsQDYCSSYHATIAPAEGYPGMAPVLRPGGIGLKDNLLFAALSAKAQ 278
                                          89***********************944459******************************************* PP

                                  VOZ  72 gkevgipecegaatakspwnaaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvm 145
                                          g++vgipecegaat+kspwna+elfdl++legetirewlffdkprrafesgnrkqrslpdy+grgwhesrkqvm
  cra_locus_1044_iso_8_len_2357_ver_3 279 GRDVGIPECEGAATTKSPWNAPELFDLAVLEGETIREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQVM 352
                                          ************************************************************************** PP

                                  VOZ 146 kefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekksakgkvskdsladlqkklgrlta 217
                                          +efgglkrsyymdpqp++s+ewhlyeyein++d +alyrlelklvd+kks+kgkv++ds++dlqk++ +lta
  cra_locus_1044_iso_8_len_2357_ver_3 353 NEFGGLKRSYYMDPQPMKSYEWHLYEYEINKYDVCALYRLELKLVDGKKSPKGKVANDSVSDLQKQMKKLTA 424
                                          **********************************************************************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 484 aa     Download sequence    Send to blast
MGKGSKSGAC KSASHQLFKD RAKNRVDDLQ GMFSDLQSAR KESRTIDVAV LEEQVHQMLR  60
EWKAELNEPS PASSLQGGSL GSFSSDIYRL LQLCEEEDDA TSSLTPPKSE PGIQKVDGGA  120
AFQEAFNNCH VTQEQSFHLL DQCKNTPGAN TMGISNMGVA APLDYHPFDL HQDFEHQYFT  180
GFEGTGICGE DALSQIPNFA QNFCPPPAAF LGPKCALWDC PRPAQRLEWC QTSQDYCSSY  240
HATIAPAEGY PGMAPVLRPG GIGLKDNLLF AALSAKAQGR DVGIPECEGA ATTKSPWNAP  300
ELFDLAVLEG ETIREWLFFD KPRRAFESGN RKQRSLPDYN GRGWHESRKQ VMNEFGGLKR  360
SYYMDPQPMK SYEWHLYEYE INKYDVCALY RLELKLVDGK KSPKGKVAND SVSDLQKQMK  420
KLTAEFPSDN KRTVKGNSKA NTKDVNGSIH SNPNRMPQTN EAFDYGTGAP FEYLVDNLNG  480
YYIT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011086027.10.0PREDICTED: transcription factor VOZ1-like isoform X1
RefseqXP_011086028.10.0PREDICTED: transcription factor VOZ1-like isoform X1
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A068TU110.0A0A068TU11_COFCA; Uncharacterized protein
STRINGVIT_10s0003g00500.t010.0(Vitis vinifera)